Protein coding transcript 246543

• Transcript: Ll_transcript_118260
• CDS coordinates: 845-1549 (+)
• Peptide sequence: MQRLHKKGVSFCTRTTYDDNAITNAIDIYDSLRGGIRFMASNNDCGVREYDMERFQLLNHFHFLWPVNHTSISPDQKLMTVVGDSLDGLLVDPQNGKTVATLVGHRDYSFASAWHPDGHTFATGNQDKTCRVWDARRLSSPIAILKGNLGAARSIRFSSDGQYIVVAEPADFVHVYSIKEDYKKRQEIDFFGEISGVSLSPDDECMYIGIWDRTYASLLQYNKKHAYGYLDSYF*
• ORF Type: complete

Annotations of Ll_transcript_118260

• Blastp: Uncharacterized WD repeat-containing protein C2A9.03 from Schizosaccharomyces with 31.8% of identity
• Blastx: Uncharacterized WD repeat-containing protein C2A9.03 from Schizosaccharomyces with 31.8% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC2A9.03)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428841.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;