Transcript | Ll_transcript_120692 |
---|---|
CDS coordinates | 60-464 (+) |
Peptide sequence | MALKKRNAIINLILPLIVLFQIQTCKSDINREDFPKGFTFGTASSAFQVEGAVREDGRGPSIWDTFSHTFGKIADFSNADVAVDHYHRIEEDIQIMKDLGVDAYRFSISWSRIFPNGSGAINQAGVDHYNKVINA |
ORF Type | 3prime_partial |
Blastp | Beta-glucosidase 34 from Oryza sativa with 64.66% of identity |
---|---|
Blastx | Beta-glucosidase 34 from Oryza sativa with 64.66% of identity |
Eggnog | beta-glucosidase(COG2723) |
Kegg | Link to kegg annotations (4348315) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424172.1) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer