Protein coding transcript 246761

• Transcript: Ll_transcript_119741
• CDS coordinates: 1-372 (+)
• Peptide sequence: PGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPVIIAIEFMAIAFAEIQRVVEKDTEKKKYPGGYFDPLGYSQDVEKFEEYKVKELKNGRLALLACLGFAVQQSVYPGTGPLDNLA
• ORF Type: internal

Annotations of Ll_transcript_119741

• Blastp: Chlorophyll a-b binding protein 6A, chloroplastic from Lycopersicon with 80.65% of identity
• Blastx: Chlorophyll a-b binding protein 6A, chloroplastic from Lycopersicon with 80.65% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG410XVD6)
• Kegg: Link to kegg annotations (544310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413591.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;