Transcript | Ll_transcript_120010 |
---|---|
CDS coordinates | 512-1117 (+) |
Peptide sequence | MATFFMALGHYLYIWRLHGMTFHLVDAVLFLNIRALLGAIVNRIKGFIRLRIALGALHAALTDATTEELRAYDDECAICREPMAKAKRLNCNHLFHLGCLRSWLDQGLTEMYTCPTCRKPLFVGQPENEANSTTEEISSDEQLARQMSAGLDRANSARHTSPAELYPDQTQNIVEGVPWRGAGLDAGWLHSWPNQGVDGAGP |
ORF Type | 3prime_partial |
Blastp | E3 ubiquitin protein ligase RIN2 from Arabidopsis with 70.79% of identity |
---|---|
Blastx | E3 ubiquitin protein ligase RIN2 from Arabidopsis with 68.75% of identity |
Eggnog | zinc ion binding(COG5243) |
Kegg | Link to kegg annotations (AT4G25230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427189.1) |
Pfam | Anaphase-promoting complex subunit 11 RING-H2 finger (PF12861.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer