Transcript | Ll_transcript_119935 |
---|---|
CDS coordinates | 254-1294 (+) |
Peptide sequence | MACSSSSGSEEDDEGFDSYRKGGYHAVRVADQFAGGRYIAQRKLGWGQFSTVWLAYDIQTSSYVALKIQKSAAEFVQAALHEINVLSSITNSDSSNSRCLVQLIDHFKHTGPNGQHLCMVLEFLGDNLLRLIKYNHYKGLPLSKVRAVCKCILIGLDYLHRELGIIHTDLKPENVLLFSAIDPSKDPFRSGVSPILEKPEGNINGGFTSLIEKRLKIRARRAVAKISLKRGSMGGIAEAPDFGRNIDGIDMRCKIVDFGNACWADKPLAEEIQTRQYRAPEVILKAGYSFSVDMWSFACIAFELATGDVLFTPKGGGQGFCEDEDHLARMMELLGKMPRKVSTLPR* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase SRPK from Physarum with 45.61% of identity |
---|---|
Blastx | Serine/threonine-protein kinase SRPK from Physarum with 46.36% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424193.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer