Protein coding transcript 246885

• Transcript: Ll_transcript_119912
• CDS coordinates: 254-1231 (+)
• Peptide sequence: MACSSSSGSEEDDEGFDSYRKGGYHAVRVADQFAGGRYIAQRKLGWGQFSTVWLAYDIQTSSYVALKIQKSAAEFVQAALHEINVLSSITNSDSSNSRCLVQLIDHFKHTGPNGQHLCMVLEFLGDNLLRLIKYNHYKGLPLSKVRAVCKCILIGLDYLHRELGIIHTDLKPENVLLFSAIDPSKDPFRSGVSPILEKPEGNINGGFTSLIEKRLKIRARRAVAKISLKRGSMGGIAEAPDFGRNIDGIDMRCKIVDFGNACWADKPLAEEIQTRQYRAPEVILKAGYSFSVDMWSFACIAFELATGDVLFTPKGGGQGFCEDEV*
• ORF Type: complete

Annotations of Ll_transcript_119912

• Blastp: Serine/threonine-protein kinase SRPK from Physarum with 45.11% of identity
• Blastx: Serine/threonine-protein kinase SRPK from Physarum with 45.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424193.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;