Protein coding transcript 246951

• Transcript: Ll_transcript_118688
• CDS coordinates: 1-801 (+)
• Peptide sequence: TWHSALATSNGKLFTFGDGRFGVMGHGDRESVLYPTEVQLSSGQKAIKVACGVWHTAAIIEVTDPSVSNASSRKQLFTWGDGDQYRLGHINKETYLQPTCVSTLAEYDFQQVACGNTMTVALTLSGHVFIMGSNAYGQIGNPLSDGKVPILVRDKLVGECVEEISCGSHHVAVLTSRSELYTWGRGANGRLGHGDIDDQKSPKLVEAFKDRHVKNISCGSNFTTCICIHKWVSGADQSLCTGCRQPFGFTKKRHNCYNCGLVHCHGC
• ORF Type: internal

Annotations of Ll_transcript_118688

• Blastp: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 64.79% of identity
• Blastx: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 64.79% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (AT1G76950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431965.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;