Protein coding transcript 247001

• Transcript: Ll_transcript_118402
• CDS coordinates: 173-760 (+)
• Peptide sequence: MSTIIEDKIIEESKCSEQEEDLVKLLLPDVHNLPLIPPSAVESNFVTYFAIDFTKPAHDHYVYRHANGLCVIGLASSHVAFKDEGGITDIDFNVGKSDRSGVKVTGKRKKNAQHFEANTALCKVNTKNDSYIVRCCVKGSLLEVNQLLINQPELLNVSAEREGYIAIMMPKPADWLKAKASLVSLQEYKKLRELS*
• ORF Type: complete

Annotations of Ll_transcript_118402

• Blastp: Protein Simiate from Mus with 33.51% of identity
• Blastx: Protein Simiate from Mus with 33.51% of identity
• Eggnog: family with sequence similarity 206, member A(ENOG4111FVG)
• Kegg: Link to kegg annotations (230234)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438070.1)
• Pfam: Glycine cleavage H-protein (PF01597.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;