Transcript | Ll_transcript_118402 |
---|---|
CDS coordinates | 173-760 (+) |
Peptide sequence | MSTIIEDKIIEESKCSEQEEDLVKLLLPDVHNLPLIPPSAVESNFVTYFAIDFTKPAHDHYVYRHANGLCVIGLASSHVAFKDEGGITDIDFNVGKSDRSGVKVTGKRKKNAQHFEANTALCKVNTKNDSYIVRCCVKGSLLEVNQLLINQPELLNVSAEREGYIAIMMPKPADWLKAKASLVSLQEYKKLRELS* |
ORF Type | complete |
Blastp | Protein Simiate from Mus with 33.51% of identity |
---|---|
Blastx | Protein Simiate from Mus with 33.51% of identity |
Eggnog | family with sequence similarity 206, member A(ENOG4111FVG) |
Kegg | Link to kegg annotations (230234) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438070.1) |
Pfam | Glycine cleavage H-protein (PF01597.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer