Protein coding transcript 247007

• Transcript: Ll_transcript_120995
• CDS coordinates: 131-544 (+)
• Peptide sequence: MYLGDIVRRALLKLAEEADFFGDTVPPKLRVPFIIRTPDMSAMHHDTSPDLKVVGNKFRDILEISNTSLKMRKVVVELCDIVANRGARLAAAGIFGILKKMGRDTAKAGENSKSVIALDGGLFEHYTKFRTCLENTLK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_120995

• Blastp: Hexokinase-1 from Arabidopsis with 73.19% of identity
• Blastx: Hexokinase-1 from Nicotiana with 72.11% of identity
• Eggnog: hexokinase(COG5026)
• Kegg: Link to kegg annotations (AT4G29130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424269.1)
• Pfam: Hexokinase (PF03727.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;