Protein coding transcript 247064

• Transcript: Ll_transcript_121222
• CDS coordinates: 358-1071 (+)
• Peptide sequence: MARYASLKMETEETFDATRWLDRLLIRLCSKFGDYRKDDPSSFTLNPSFSLFPQFMFNLRRSQFLQVFNNSPDETAYFRMVLNRENISNAAVMIQPSLISYSFNSVPAPALLDVSSIAADRILLLDSYFSVVIFHGMTIAQWRNLGYHHQPEHQAFAQLLQAPHDDAVSIIRDRFPVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAVQS*
• ORF Type: complete

Annotations of Ll_transcript_121222

• Blastp: Protein transport protein SEC23 from Cryptococcus neoformans species complex with 61.34% of identity
• Blastx: Protein transport protein SEC23 from Cryptococcus neoformans species complex with 60.39% of identity
• Eggnog: transport protein(COG5047)
• Kegg: Link to kegg annotations (CNJ01150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004502261.1)
• Pfam: Sec23/Sec24 helical domain (PF04815.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;