Protein coding transcript 247073

• Transcript: Ll_transcript_121217
• CDS coordinates: 358-948 (+)
• Peptide sequence: MARYASLKMETEETFDATRWLDRLLIRLCSKFGDYRKDDPSSFTLNPSFSLFPQFMFNLRRSQFLQVFNNSPDETAYFRMMLNRENISNAAVMIQPSLISYSFNSLPAPALLDVASIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAQVLEAPHDDAEMIVRERFPVPRLVVCDQHGSQVSIVYQY*
• ORF Type: complete

Annotations of Ll_transcript_121217

• Blastp: Protein transport protein SEC23 from Ustilago with 59.26% of identity
• Blastx: Protein transport protein SEC23 from Ustilago with 58.25% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (UMAG_01624)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004502261.1)
• Pfam: Sec23/Sec24 helical domain (PF04815.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;