Transcript | Ll_transcript_210613 |
---|---|
CDS coordinates | 437-847 (+) |
Peptide sequence | MLYDGDCPLCMREVNMLRERNKTYGTIKFVDISSDDYSPEGNQGLDYQTAMGRIHAVLSDGTVVTDVEAFRRLYEQVGLGWVYAITKYEPIAKIADSIYGVWAKYRLQVTGRPPMEQILEARKKKGEICKDNACKM* |
ORF Type | complete |
Blastp | Uncharacterized protein At5g50100, mitochondrial from Arabidopsis with 75.36% of identity |
---|---|
Blastx | Uncharacterized protein At5g50100, mitochondrial from Arabidopsis with 74.5% of identity |
Eggnog | Protein of unknown function, DUF393(COG3011) |
Kegg | Link to kegg annotations (AT5G50100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431700.1) |
Pfam | Protein of unknown function, DUF393 (PF04134.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer