Protein coding transcript 247130

• Transcript: Ll_transcript_210621
• CDS coordinates: 64-738 (+)
• Peptide sequence: MALRLAAVSASHIARPKNPSFFSAPQPNITLKPRPISKFGSKWHIRAISEAAAEPSISKKEGEEQWPKDWKIKMLYDGDCPLCMREVNMLRERNKTYGTIKFVDISSDDYSPEGNQGLDYQTAMGRIHAVLSDGTVVTDVEAFRRLYEQVGLGWVYAITKYEPIAKIADSIYGVWAKYRLQVTGRPPMEQILEARKKKVDILNYIKQHFNFSIGCTNIIKIGKR*
• ORF Type: complete

Annotations of Ll_transcript_210621

• Blastp: Uncharacterized protein At5g50100, mitochondrial from Arabidopsis with 65.41% of identity
• Blastx: Uncharacterized protein At5g50100, mitochondrial from Arabidopsis with 78.52% of identity
• Eggnog: Protein of unknown function, DUF393(COG3011)
• Kegg: Link to kegg annotations (AT5G50100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431697.1)
• Pfam: Protein of unknown function, DUF393 (PF04134.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;