Protein coding transcript 247390

• Transcript: Ll_transcript_210352
• CDS coordinates: 2286-2606 (+)
• Peptide sequence: MHFAAVAYVGESTVDPLKYYHNITSNTLLVLESMAKHDVKTLIYSSTCATYGEPDVMPITEETKQNPINPYGRAKKMAEDIILDFSRNSDMAVMILRFVFYISPSF*
• ORF Type: complete

Annotations of Ll_transcript_210352

• Blastp: UDP-arabinose 4-epimerase 1 from Arabidopsis with 87.76% of identity
• Blastx: UDP-arabinose 4-epimerase 1 from Arabidopsis with 89.5% of identity
• Eggnog: udp-glucose 4-epimerase(COG1087)
• Kegg: Link to kegg annotations (AT1G30620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460006.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;