Transcript | Ll_transcript_210357 |
---|---|
CDS coordinates | 2-448 (+) |
Peptide sequence | IYSSTCATYGEPEKMPITEITEQKPINPYGKAKKMAEDIILDFSKNSKMAVMILRYFNVIGSDPEGRLGEAPRPELRERGRISGACFDAARGSIPGLKVRGTDYETVDGTCVRDYIDVTDLVDAHVKALEKAQSGKVGICNVGTGKSR* |
ORF Type | 5prime_partial |
Blastp | Putative UDP-arabinose 4-epimerase 2 from Arabidopsis with 89.73% of identity |
---|---|
Blastx | Putative UDP-arabinose 4-epimerase 2 from Arabidopsis with 84.08% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT2G34850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014505786.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer