Protein coding transcript 247396

• Transcript: Ll_transcript_210359
• CDS coordinates: 225-776 (+)
• Peptide sequence: MVVIIYNFSLGAYRYFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARGITPGLKVRGTDYKTADGTCIRDYIDVTDLVDAHVKALEKAQPAKVGIYNVGTGKGRSVKEFVDACKKATGADIKVDFLPRRPGDYAEVYSDPTKIRLELNWTAQHIDLEKSLQVAWKWQKSHRDGYGISSAI*
• ORF Type: complete

Annotations of Ll_transcript_210359

• Blastp: UDP-arabinose 4-epimerase 1 from Arabidopsis with 76.76% of identity
• Blastx: UDP-arabinose 4-epimerase 1 from Arabidopsis with 75.13% of identity
• Eggnog: udp-glucose 4-epimerase(COG1087)
• Kegg: Link to kegg annotations (AT1G30620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440132.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;