Protein coding transcript 247399

• Transcript: Ll_transcript_210339
• CDS coordinates: 2-664 (+)
• Peptide sequence: IYSSTCATYGEPEKMPITEITEQKPINPYGKAKKMAEDIILDFSKNSKMAVMILRYFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARGITPGLKVRGTDYKTADGTCIRDYIDVTDLVDAHVKALEKAQPAKVGIYNVGTGKGRSVKEFVDACKKATGADIKVDFLPRRPGDYAEVYSDPTKILLELNWSAQHTDLEKSLQVAWKWQKSHRDGYGI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_210339

• Blastp: Probable UDP-arabinose 4-epimerase 3 from Arabidopsis with 85.78% of identity
• Blastx: Probable UDP-arabinose 4-epimerase 3 from Arabidopsis with 85.78% of identity
• Eggnog: udp-glucose 4-epimerase(COG1087)
• Kegg: Link to kegg annotations (AT4G20460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440132.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;