Protein coding transcript 247400

• Transcript: Ll_transcript_210364
• CDS coordinates: 2-679 (+)
• Peptide sequence: IYSSTCATYGEPEKMPITEITEQKPINPYGKAKKMAEDIILDFSKNSKMAVMILRYFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARGITPGLKVRGTDYKTADGTCIRDYIDVTDLVDAHVKALEKAQPAKVGIYNVGTGKGRSVKEFVDACKKATGVNIKVDFLERRPGDYAEVYSDPTKIKRELNWTAKHTDLKESLQAAWRWQKSHRDGYGVSNAIY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_210364

• Blastp: Putative UDP-arabinose 4-epimerase 2 from Arabidopsis with 86.16% of identity
• Blastx: Putative UDP-arabinose 4-epimerase 2 from Arabidopsis with 86.16% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G34850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440132.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;