Protein coding transcript 247478

• Transcript: Ll_transcript_210915
• CDS coordinates: 1-324 (+)
• Peptide sequence: SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGIIEPSLMALARKYNQDKTICRKYGSLLLENNLSHSVNESITCVLFCLVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_210915

• Blastp: Ubiquitin-60S ribosomal protein L40 from Nicotiana with 98.75% of identity
• Blastx: Ubiquitin-60S ribosomal protein L40 from Nicotiana with 98.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: hsa-mir-4426 (MI0016765)
• Ncbi protein: Link to NCBI protein (XP_013461443.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;