| Transcript | Ll_transcript_211612 |
|---|---|
| CDS coordinates | 321-680 (+) |
| Peptide sequence | MGCLHSKVKREYSGKEDPRFLASQTAFTVSEVEALFELYKSISESVVDDGLISKEEFQLAIFKNRKIENIFANRVLLTYIRIFMFFLSKQKSMFICFANCYKNFADIFIVLVVSPIIIY* |
| ORF Type | complete |
| Blastp | Calcineurin B-like protein 1 from Arabidopsis with 76% of identity |
|---|---|
| Blastx | Calcineurin B-like protein 1 from Arabidopsis with 76% of identity |
| Eggnog | Calcium-binding protein(COG5126) |
| Kegg | Link to kegg annotations (AT4G17615) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422860.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer