Protein coding transcript 247493

• Transcript: Ll_transcript_211616
• CDS coordinates: 321-851 (+)
• Peptide sequence: MGCLHSKVKREYSGKEDPRFLASQTAFTVSEVEALFELYKSISESVVDDGLISKEEFQLAIFKNRKIENIFANRIFDLFDVKKKGVIDFEDFVRSLNVFHPTASLEDKIDFSFKLYDLDNSGFIERQEVKQMLIALLCESEMKLADEVIETIIDKVSHVCKVHGKSKILNMNVNIL*
• ORF Type: complete

Annotations of Ll_transcript_211616

• Blastp: Calcineurin B-like protein 1 from Arabidopsis with 76.19% of identity
• Blastx: Calcineurin B-like protein 1 from Arabidopsis with 67.84% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT4G17615)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422860.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;