Transcript | Ll_transcript_212368 |
---|---|
CDS coordinates | 198-977 (+) |
Peptide sequence | MMDSVLVLNFVNSTLDWVKFALDAPSARAVVFGFHIGGHLFVEVLLLVVILFLLSQKSYKPPKRPLTNKEIDELCDEWVPEPLIPSLNEEMQYEPPVLESAAGPHTIIDGKEVVNFASANYLGLIGHQKLLDSCSSALEKYGVGSCGPRGFYGTIDVHLDCEARIAKFLGTPDSILYSYGLSTMFSAIPAFSKKGDIIVADEGVHWGIQNGLYLSRSTVVYFKHNDMDSLRNTLENISSKNKRIKKLRRYIVVEAVYQNS |
ORF Type | 3prime_partial |
Blastp | Long chain base biosynthesis protein 1 from Arabidopsis with 77.99% of identity |
---|---|
Blastx | Long chain base biosynthesis protein 1 from Arabidopsis with 77.99% of identity |
Eggnog | 8-Amino-7-oxononanoate synthase(COG0156) |
Kegg | Link to kegg annotations (AT4G36480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429830.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer