Protein coding transcript 247529

• Transcript: Ll_transcript_212357
• CDS coordinates: 1289-2170 (+)
• Peptide sequence: MHAVISFRDEGVHWGIQNGLYLSRSTVVYFKHNDMDSLRNTLENITSKNKRIKKLRRYIVVEAVYQNSGQIAPLDEIIKLKEKYRFRVLLDESNSFGVLGISGRGLTEHYGVPAEKLDIITAAMGHALASEGGFCTGSARVIDHQRLSSSGYVFSASLPPYLASAAITAIDILEENPYLITKLKNNIAALWRGLSNITGFTIASNPESPIVYLRLEKSKGSTKDDLNLLEKIAHLVLKEDSVFVVPSKRSTLDNCRLPLGIRLFVSAGHSESDLHKASESLKRVAALVLGGYN*
• ORF Type: complete

Annotations of Ll_transcript_212357

• Blastp: Long chain base biosynthesis protein 1 from Arabidopsis with 76.51% of identity
• Blastx: Long chain base biosynthesis protein 1 from Arabidopsis with 76.51% of identity
• Eggnog: 8-Amino-7-oxononanoate synthase(COG0156)
• Kegg: Link to kegg annotations (AT4G36480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429830.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;