Transcript | Ll_transcript_212379 |
---|---|
CDS coordinates | 1325-2206 (+) |
Peptide sequence | MHAVISFRDEGVHWGIQNGLYLSRSTVVYFKHNDMDSLRNTLENITSKNKRIKKLRRYIVVEAVYQNSGQIAPLDEIIKLKEKYRFRVLLDESNSFGVLGISGRGLTEHYGVPAEKLDIITAAMGHALASEGGFCTGSARVIDHQRLSSSGYVFSASLPPYLASAAITAIDILEENPYLITKLKNNIAALWRGLSNLTGLTITSNPESPIVYLRLEKSTGSMKDDLHLLENIAERVLKEDSVFVVVSKRSTLDNCHLPLGIRLFVSAGHTESDLHKASESLKRVAALVLGSHN* |
ORF Type | complete |
Blastp | Long chain base biosynthesis protein 1 from Arabidopsis with 75.8% of identity |
---|---|
Blastx | Long chain base biosynthesis protein 1 from Arabidopsis with 75.8% of identity |
Eggnog | 8-Amino-7-oxononanoate synthase(COG0156) |
Kegg | Link to kegg annotations (AT4G36480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447135.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer