Protein coding transcript 247536

• Transcript: Ll_transcript_212360
• CDS coordinates: 3-302 (+)
• Peptide sequence: MYSAVVLNFVNTTLDWVKFALDAPSARAVVFGFHIGGHLFVEVLLLVVILFLLSQKSYKPPKRPLTNKEIDELCDDWVPEPLIPSLNEEMHYEPPVLER*
• ORF Type: complete

Annotations of Ll_transcript_212360

• Blastp: Long chain base biosynthesis protein 1 from Arabidopsis with 64.29% of identity
• Blastx: Long chain base biosynthesis protein 1 from Arabidopsis with 63.44% of identity
• Eggnog: 8-Amino-7-oxononanoate synthase(COG0156)
• Kegg: Link to kegg annotations (AT4G36480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429830.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;