Protein coding transcript 24756

• Transcript: Ll_transcript_389935
• CDS coordinates: 365-1339 (+)
• Peptide sequence: MQELVRLRQQQQTTDNQLQSMVQRLQGMEQRQQQMMSFLAKAVQSPGFFAQFVQQKNDSNRHITEVNKKRRLKQEGISETEHAAAPDGQIVKYQPVMNEAAKAMLRQIMAWDASRVKSFSKSPVSYLIGDDSPPPSTLDSSSSSSRASGVTLQEVSPASMQSSHIPTAKGIQGHIPPENLSSTQTAASEKVTKVGVPEAPSICVPQADMIMPDLSPITGNILDIPDENLMCPETGSDTFMDPTSLGASESFPLDFDGIPPDADIEDFLGNPSIWDDFLQTPVSEDIETDVAEVSEGNEVQPTGNGWNKTEHLDQLTEQMGTSFI*
• ORF Type: complete

Annotations of Ll_transcript_389935

• Blastp: Heat shock factor protein HSF8 from Lycopersicon with 45.96% of identity
• Blastx: Heat shock factor protein HSF8 from Lycopersicon with 48.11% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424141.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;