Transcript | Ll_transcript_389944 |
---|---|
CDS coordinates | 3-1289 (+) |
Peptide sequence | EFARDLLPKHFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLRSITRRKPAHGHNQQQAQQSHAQSSSPVGACVEVGKFGLEEEVERLKRDKNVLMQELVRLRQQQQTTDNQLQSMVQRLQGMEQRQQQMMSFLAKAVQSPGFFAQFVQQKNDSNRHITEVNKKRRLKQEGISETEHAAAPDGQIVKYQPVMNEAAKAMLRQIMAWDASRVKSFSKSPVSYLIGDDSPPPSTLDSSSSSSRASGVTLQEVSPASMQSSHIPTAKGIQGHIPPENLSSTQTAASEKVTKVGVPEAPSICVPQADMIMPDLSPITGNILDIPDENLMCPETGSDTFMDPTSLGASESFPLDFDGIPPDADIEDFLGNPSIWDDFLQTPVSEDIETDVAEVSEGNEVQPTGNGWNKTEHLDQLTEQMGTSFI* |
ORF Type | 5prime_partial |
Blastp | Heat shock factor protein HSF8 from Lycopersicon with 53.81% of identity |
---|---|
Blastx | Heat shock factor protein HSF8 from Lycopersicon with 52.3% of identity |
Eggnog | Transcription factor(COG5169) |
Kegg | Link to kegg annotations (101263626) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424141.1) |
Pfam | HSF-type DNA-binding (PF00447.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer