Transcript | Ll_transcript_211993 |
---|---|
CDS coordinates | 480-1442 (+) |
Peptide sequence | MSLQLSLHFIGLLCLLQVMASKRQYKEAAAQLEAVNQLCSHFEAYRDIPKIIELREKFKNIKQILKSHVYSDFSSLGTGKETEETNLLQQLSDACLVVDALEPSVKEELVNNFCNRELTSYEQIFEGAELAKLDKTERRYAWIKRRMRSNEEIWKIFPSSWDVSYRLCILFCKKTRKQLEEILSTLKEKPDVGTLLLALQRTIEFEDELAEKFGGGTQNREIGNEIEKIGRGANSSINASDIRKKYEKRLAAHQGTGSEEKDGSKDLAVPGAGFNFRGIISSCFEPHLTVYVELEEKTLMESLEKLVQEETWDIEEGSQNS |
ORF Type | 3prime_partial |
Blastp | Vacuolar protein sorting-associated protein 53 A from Arabidopsis with 74.38% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 53 A from Arabidopsis with 74.38% of identity |
Eggnog | Vacuolar Protein(ENOG410XNMT) |
Kegg | Link to kegg annotations (AT1G50500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440054.1) |
Pfam | Vps53-like, N-terminal (PF04100.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer