Protein coding transcript 247591

• Transcript: Ll_transcript_211993
• CDS coordinates: 480-1442 (+)
• Peptide sequence: MSLQLSLHFIGLLCLLQVMASKRQYKEAAAQLEAVNQLCSHFEAYRDIPKIIELREKFKNIKQILKSHVYSDFSSLGTGKETEETNLLQQLSDACLVVDALEPSVKEELVNNFCNRELTSYEQIFEGAELAKLDKTERRYAWIKRRMRSNEEIWKIFPSSWDVSYRLCILFCKKTRKQLEEILSTLKEKPDVGTLLLALQRTIEFEDELAEKFGGGTQNREIGNEIEKIGRGANSSINASDIRKKYEKRLAAHQGTGSEEKDGSKDLAVPGAGFNFRGIISSCFEPHLTVYVELEEKTLMESLEKLVQEETWDIEEGSQNS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_211993

• Blastp: Vacuolar protein sorting-associated protein 53 A from Arabidopsis with 74.38% of identity
• Blastx: Vacuolar protein sorting-associated protein 53 A from Arabidopsis with 74.38% of identity
• Eggnog: Vacuolar Protein(ENOG410XNMT)
• Kegg: Link to kegg annotations (AT1G50500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440054.1)
• Pfam: Vps53-like, N-terminal (PF04100.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;