Protein coding transcript 247597

• Transcript: Ll_transcript_211985
• CDS coordinates: 468-1547 (+)
• Peptide sequence: MYKIREIKTKAVQSETMVQEICRDIKKLDFAKKHVTTTITALHRLTMLVSAVEQLQVMASKRQYKEAAAQLEAVNQLCSHFEAYRDIPKIIELREKFKNIKQILKSHVYSDFSSLGTGKETEETNLLQQLSDACLVVDALEPSVKEELVNNFCNRELTSYEQIFEGAELAKLDKTERRYAWIKRRMRSNEEIWKIFPSSWDVSYRLCILFCKKTRKQLEEILSTLKEKPDVGTLLLALQRTIEFEDELAEKFGGGTQNREIGNEIEKIGRGANSSINASDIRKKYEKRLAAHQGTGSEEKDGSKDLAVPGAGFNFRGIISSCFEPHLTVYVELEEKTLMESLEKLVQEETWDIEEGSQNS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_211985

• Blastp: Vacuolar protein sorting-associated protein 53 A from Arabidopsis with 78.24% of identity
• Blastx: Vacuolar protein sorting-associated protein 53 A from Arabidopsis with 78.5% of identity
• Eggnog: Vacuolar Protein(ENOG410XNMT)
• Kegg: Link to kegg annotations (AT1G50500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440054.1)
• Pfam: Vps53-like, N-terminal (PF04100.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;