Protein coding transcript 247636

• Transcript: Ll_transcript_211087
• CDS coordinates: 627-1256 (+)
• Peptide sequence: MSRSIQRILKYPPTRTLSGDERQLLWKFRFSLMSEKRALTKFLRCVEWSDVQEAKQALELMGKWEMIDVCDALELLSPVFESEEVRAYAVSVLERADDEELQCYLLQLVQALRFERSDKSRLSHFLFQRALCNIELASFLRWYVAVELYDPAYAKRFYCTYEILEENMMKMAAGMNGEDDGFKLWQSLVRQTELTAQLCSISRDVRNVRG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_211087

• Blastp: Phosphatidylinositol 3-kinase, root isoform from Soja with 95.67% of identity
• Blastx: Phosphatidylinositol 3-kinase, root isoform from Soja with 95.67% of identity
• Eggnog: phosphatidylinositol kinase activity(COG5032)
• Kegg: Link to kegg annotations (547983)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445446.1)
• Pfam: Phosphoinositide 3-kinase family, accessory domain (PIK domain) (PF00613.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;