Protein coding transcript 247653

• Transcript: Ll_transcript_211173
• CDS coordinates: 300-695 (+)
• Peptide sequence: MSRKGLMEQDLKKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDERCPRPMSYKAYGSGKEDAPMCDAPGFENCKMKLLRHVSFVDCPVMS*
• ORF Type: complete

Annotations of Ll_transcript_211173

• Blastp: Eukaryotic translation initiation factor 2 subunit 3 from Sophophora with 72.44% of identity
• Blastx: Eukaryotic translation initiation factor 2 subunit 3 from Sophophora with 72.44% of identity
• Eggnog: translation initiation factor(COG5257)
• Kegg: Link to kegg annotations (Dmel_CG43665)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461644.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;