Protein coding transcript 247654

• Transcript: Ll_transcript_211174
• CDS coordinates: 1293-1967 (+)
• Peptide sequence: MIVIRSFDVNKPGFEVDDIKGGVAGGSILRGVLKVNQFIEVRPGIVVKDEVGNIKCTPIYSRIVSLFAEQNELQFAVPGGLIGVGTTMDPTLTRADRLVGQVLGAVGSLPEVFVELEVNFFLLRRLLGVRTKGTERQGKVSKLAKGEMLMLNIGSMSTGARVVAVKNDLAKLQLTSPVCTSKGEKIALSRRVEKHWRLIGWGQIQAGITLDVPSAPFSVADIVE*
• ORF Type: complete

Annotations of Ll_transcript_211174

• Blastp: Eukaryotic translation initiation factor 2 subunit 3 from Danio with 74.29% of identity
• Blastx: Eukaryotic translation initiation factor 2 subunit 3 from Homo with 69.92% of identity
• Eggnog: translation initiation factor(COG5257)
• Kegg: Link to kegg annotations (327341)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461644.1)
• Pfam: Elongation factor Tu domain 2 (PF03144.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;