Protein coding transcript 247668

• Transcript: Ll_transcript_211890
• CDS coordinates: 1617-2069 (+)
• Peptide sequence: MRGFIQSLQVLGSIVGVKLIIDTIPEVGRGPRLNIDIHQGALTEGLLTFVIVTISLGLTAKIRGSFFMKTWISSLSKLTLHILGSDLTGGCMNPASVMGWAYARGDHITKEHILVYWLAPIEATILAVWTFKWLVKPAKEDKTDSKSKSD*
• ORF Type: complete

Annotations of Ll_transcript_211890

• Blastp: Probable aquaporin SIP2-1 from Arabidopsis with 69.23% of identity
• Blastx: Probable aquaporin SIP2-1 from Arabidopsis with 72.18% of identity
• Eggnog: Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity (By similarity)(COG0580)
• Kegg: Link to kegg annotations (AT3G56950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458030.1)
• Pfam: Major intrinsic protein (PF00230.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;