Transcript | Ll_transcript_211893 |
---|---|
CDS coordinates | 573-1076 (+) |
Peptide sequence | MMFQVNHFALEKMQHTENEEQKFNVRKLEISDKGKGFIELLQQLSVCDSVSNDEFEHRFQELSSLGEDHVICVIEDEVSGKIVATGSVFIEKKFLRNCGKVGHIEDVVVDSGIRGKQLGKKIINFLTDHAHSIGCYKVILDCSLDNKVFYEKCGFKQKEVQMVRYFI* |
ORF Type | complete |
Blastp | Glucosamine 6-phosphate N-acetyltransferase from Arabidopsis with 71.23% of identity |
---|---|
Blastx | Glucosamine 6-phosphate N-acetyltransferase from Arabidopsis with 71.23% of identity |
Eggnog | acetyltransferase(COG0454) |
Kegg | Link to kegg annotations (AT5G15770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432915.1) |
Pfam | Acetyltransferase (GNAT) family (PF00583.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer