Transcript | Ll_transcript_210800 |
---|---|
CDS coordinates | 2-559 (+) |
Peptide sequence | GTDYLLKATVHPNIIYVQVGDAKKDHACWERPEDMDTPRSVFKIDANNPGSEVAAETAAALAAASLVFRRTDPAYSKILVRRAIRVFQFADKYRGAYSNSLKHVVCPFYCDYSGYLDELLWGAAWLHKATKNPMYLNYIQVNGHVLGAAQFDNTFGWDNKHVGARILLSKVHLHPFFILGLLQNQ* |
ORF Type | 5prime_partial |
Blastp | Endoglucanase 17 from Arabidopsis with 76.16% of identity |
---|---|
Blastx | Endoglucanase 17 from Arabidopsis with 75.72% of identity |
Eggnog | hydrolase family(ENOG410XPC9) |
Kegg | Link to kegg annotations (AT4G02290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441322.1) |
Pfam | Glycosyl hydrolase family 9 (PF00759.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer