Protein coding transcript 2477

• Transcript: Ll_transcript_524782
• CDS coordinates: 3-665 (+)
• Peptide sequence: RVEGFNDVYALGDCATINQRKVMEDIAAIFKKADKNNSGTLTVKEFQEVMGDICERYPQVELYLKNKQMSNISDLLKEDNVDVKKQLNIEELKTALSKVDSQMKFLPATAQVASQQGTYLAKCFNRMEDCEENPEGPLRFRGEGRHRFKPFRYKHLGQFAPLGGEKTAAQLPGDWVSIGHSSQWLWYSVYASKQVTWRTRALVVTDWTRRFVFGRDSSRI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524782

• Blastp: External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial from Arabidopsis with 79.02% of identity
• Blastx: External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial from Arabidopsis with 79.02% of identity
• Eggnog: Nadh dehydrogenase(COG1252)
• Kegg: Link to kegg annotations (AT4G21490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418371.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;