Protein coding transcript 247733

• Transcript: Ll_transcript_212725
• CDS coordinates: 249-560 (+)
• Peptide sequence: MTIYWGAAVLYKDNNQTLSKSKDIPPVNRTLNGPDKWMNVLCKKLVTWWQWVAVGKIPLMPSKGKMMMQVCLIHLWVQVNHPEPAIFRIFFMYFVFKVLYETT*
• ORF Type: complete

Annotations of Ll_transcript_212725

• Blastp: DDT domain-containing protein DDR4 from Arabidopsis with 43.18% of identity
• Blastx: DDT domain-containing protein DDR4 from Arabidopsis with 43.18% of identity
• Eggnog: Aminoacyl-t-RNA synthetase(ENOG410Z49E)
• Kegg: Link to kegg annotations (AT1G18950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414642.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;