Protein coding transcript 247779

• Transcript: Ll_transcript_210758
• CDS coordinates: 2-322 (-)
• Peptide sequence: LPFDGPNLIDLYKKISAAEFTCPPWLSFSARKLISRILDPNPVTRITVAEILDNEWFKIDYKPPVFIEKAETSLDDVEAVFKDCENHHVTEKKEQQPTSMNAFKLIS
• ORF Type: internal

Annotations of Ll_transcript_210758

• Blastp: CBL-interacting serine/threonine-protein kinase 26 from Arabidopsis with 69.16% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 26 from Arabidopsis with 69.16% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G21326)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434424.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;