Protein coding transcript 247817

• Transcript: Ll_transcript_212387
• CDS coordinates: 36-602 (+)
• Peptide sequence: MQEVTGLNYLLPSTYPTNYNKFQFQTFPNQLYSFHNNPFQIHENFSPQSSGISSNSTSDEADDQNLSLINERKHRRMISNRESARRSRMRKQKQLDELWSQVMWLRNENHKLLDKVNHASECYDQVLQENAKLKEQTSELQQMIRDMQIHSPCPSFGTFEDVPCDSSYLRISDSSNQSISSNSMDFLG*
• ORF Type: complete

Annotations of Ll_transcript_212387

• Blastp: Basic leucine zipper 43 from Arabidopsis with 56.3% of identity
• Blastx: Basic leucine zipper 43 from Arabidopsis with 56.3% of identity
• Eggnog: Transcription factor(ENOG410YWTI)
• Kegg: Link to kegg annotations (AT5G38800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451960.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;