Protein coding transcript 247823

• Transcript: Ll_transcript_212405
• CDS coordinates: 228-1190 (+)
• Peptide sequence: MESCNWVLKYVSLLLVFFFLTSSSTYATHYSSSSSALDLVITNTTAMHRNFTAVSDFRLINRRIVNDCSASSPSLQINIISSTSTLSDNEFVTVTVTGVSKPSNDDWVAMISPSNSNVDSCVLNELYYLQTGDTAKLPLLCHYPVKAQLMRSDPDYLSCKKKECKKSENGKCSVTTCSGSIKFHVINIRSEIEFVFFSGGFLKPCLVGRSTPIRFANPNMPLYGHLSSIDSSGTSIRLTWVSGDNHPQQIQYGDGKKATSIVNTFSQDDMCSTVALPSPAKDFGWHDPGYIHSAVMTGLEPKSIFSYKYGRFDKLSVQPF*
• ORF Type: complete

Annotations of Ll_transcript_212405

• Blastp: Probable inactive purple acid phosphatase 1 from Arabidopsis with 33.48% of identity
• Blastx: Probable inactive purple acid phosphatase 27 from Arabidopsis with 27.05% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: Link to kegg annotations (AT1G13750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450858.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;