Transcript | Ll_transcript_212394 |
---|---|
CDS coordinates | 689-1066 (+) |
Peptide sequence | MTGLKPSSTFSYKYGSDTVGWSDQIQFPTPPAGGAPQELKFIAYGDMGKTPLDKSDEHYIQPRALSVIKAIADDVKSNNINSIFHIGDISYATGFLVEWDYFLQLISPVASKLPNMTTIGNHEKY* |
ORF Type | complete |
Blastp | Probable inactive purple acid phosphatase 1 from Arabidopsis with 37.3% of identity |
---|---|
Blastx | Probable inactive purple acid phosphatase 1 from Arabidopsis with 39.07% of identity |
Eggnog | Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409) |
Kegg | Link to kegg annotations (AT1G13750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465289.1) |
Pfam | Calcineurin-like phosphoesterase (PF00149.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer