Transcript | Ll_transcript_210452 |
---|---|
CDS coordinates | 407-1042 (+) |
Peptide sequence | MKQKREAEELGDAMKYLENRTLDSKREMDILAALDEMKSMKSRHATVTVDEMLEALQRTAADKEKRLEEEDEKLIKSVVFHSSNAFVRRVRDEDIENEEETVQVSNAHGETSSNNPKRQKNSEDLPGNATDTPRKAPLDDSSKQENSRGGGGGGGGGGDGKLNPLVRISVIKKAVISDAAEPEQKNNEEDDKTNSTSGLLSLCQNYGSDDD* |
ORF Type | complete |
Blastp | Coiled-coil domain-containing protein 94 homolog from Dictyostelium with 46.25% of identity |
---|---|
Blastx | Coiled-coil domain-containing protein 94 homolog from Dictyostelium with 64.22% of identity |
Eggnog | Coiled-coil domain-containing protein(COG5134) |
Kegg | Link to kegg annotations (DDB_G0279481) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426445.1) |
Pfam | Family of unknown function (DUF572) (PF04502.12) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer