Protein coding transcript 247839

• Transcript: Ll_transcript_210452
• CDS coordinates: 407-1042 (+)
• Peptide sequence: MKQKREAEELGDAMKYLENRTLDSKREMDILAALDEMKSMKSRHATVTVDEMLEALQRTAADKEKRLEEEDEKLIKSVVFHSSNAFVRRVRDEDIENEEETVQVSNAHGETSSNNPKRQKNSEDLPGNATDTPRKAPLDDSSKQENSRGGGGGGGGGGDGKLNPLVRISVIKKAVISDAAEPEQKNNEEDDKTNSTSGLLSLCQNYGSDDD*
• ORF Type: complete

Annotations of Ll_transcript_210452

• Blastp: Coiled-coil domain-containing protein 94 homolog from Dictyostelium with 46.25% of identity
• Blastx: Coiled-coil domain-containing protein 94 homolog from Dictyostelium with 64.22% of identity
• Eggnog: Coiled-coil domain-containing protein(COG5134)
• Kegg: Link to kegg annotations (DDB_G0279481)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426445.1)
• Pfam: Family of unknown function (DUF572) (PF04502.12)
• Rfam: -
• GO: -