Protein coding transcript 247852

• Transcript: Ll_transcript_211212
• CDS coordinates: 1349-1996 (+)
• Peptide sequence: MASFTVSNHSLPSFRMLNTQTLNYPSSQILPTPSNSHFFGLKLSNSSTFSIPSTPVSFSQKPSIFAKVSKGSKPPPFTLKDQDGKTVSLTNFKGKPVVVYFYPADDSPSCTKQACAFRDSYEKFKKAGAEVIGISGDGSSSHKAFAKKHRLPFTLLSDEGDKVRKEWGVPSDLFGALPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKLLQSL*
• ORF Type: complete

Annotations of Ll_transcript_211212

• Blastp: Peroxiredoxin Q, chloroplastic from Sedum with 80.85% of identity
• Blastx: Peroxiredoxin Q, chloroplastic from Sedum with 80.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443533.1)
• Pfam: Redoxin (PF08534.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;