Transcript | Ll_transcript_211231 |
---|---|
CDS coordinates | 271-1305 (+) |
Peptide sequence | MAPKSKVAKTSSASSPATAPFKAGFAVEVSSDDDGFRGSWFTGKIIRRLANDQLLIEYDNLMADESGKKRLREVLKLHQLRPVPPEETGREFKFGDEVDAYHNDGWWEGHVTEECGNGRFAVYFRVSREQIVFQKDELRLHREWFNENWVPPFEKQQQQQEPEKVLLTPNVKSAETVMPDMKSAQTVAPNVKPDEIVNEEERFRVGTPVEVSSDEEGFQGAWFSATVVQVIRKGKFLVEYESLLADDGSQLLREEVDSHHIRPHPPQTVVNGHFSLLEEVDAFHNDGWWVGMVSEVLDNSRYIVYFRSSSEELEFQHSQLRKHQDWIDRKWIMPSKVSHYDCTL* |
ORF Type | complete |
Blastp | DUF724 domain-containing protein 3 from Arabidopsis with 29.97% of identity |
---|---|
Blastx | DUF724 domain-containing protein 3 from Arabidopsis with 30.19% of identity |
Eggnog | Protein of unknown function (DUF724)(ENOG410YXA1) |
Kegg | Link to kegg annotations (AT1G26540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441209.1) |
Pfam | Agenet domain (PF05641.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer