Protein coding transcript 247862

• Transcript: Ll_transcript_211233
• CDS coordinates: 271-1269 (+)
• Peptide sequence: MAPKSKVAKTSSASSPATAPFKAGFAVEVSSDDDGFRGSWFTGKIIRRLANDQLLIEYDNLMADESGKKRLREVLKLHQLRPVPPEETGREFKFGDEVDAYHNDGWWEGHVTEECGNGRFAVYFRVSREQIVFHKEELRLHREWVNENWVPSFPQKQEEEKVLLKPNVMSAETVASDVKSAQTVRPNVKPVGNVTREERFSIGTPVEVSRDKEGFQGALFCATVVQVIGKRKFLVEYQSLLAGDDSQLLREEVNTHQIRPHPPKTVADGHFSLLEEVDAFHNDGWWVGMVSKVLDNSGYIVYFRNKNEELEFQHSQLRKHQDWIDRKWIMPSK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_211233

• Blastp: DUF724 domain-containing protein 3 from Arabidopsis with 29.47% of identity
• Blastx: DUF724 domain-containing protein 3 from Arabidopsis with 30% of identity
• Eggnog: Protein of unknown function (DUF724)(ENOG410YXA1)
• Kegg: Link to kegg annotations (AT1G26540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426876.1)
• Pfam: Agenet domain (PF05641.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;