Protein coding transcript 247863

• Transcript: Ll_transcript_211240
• CDS coordinates: 271-1293 (+)
• Peptide sequence: MAPKSKVAKTSSASSPATAPFKAGFAVEVSSDDDGFRGSWFTGKIIRRLANDQLLIEYDNLMADESGKKRLREVLKLHQLRPVPPEETGREFKFGDEVDAYHNDGWWEGHVTEECGNGRFAVYFRVSREQIVFQKDELRLHREWFNENWVPPFEKQQQQQEPEKVLLTPNVKSAETVMPDMKSAQTVAPNVKPDEIVNEEERFRVGTPVEVSSDEEGFQGAWFSATVVQVIRKGKFLVEYESLLADDGSQLLREEVDSHHIRPHPPQTVVNGHFSLLEEVDAFHNDGWWVGMVSEVLDNSRYIVYFRSSSEELEFQHSQLRKHQDWIDRKWIMPSKVLEL*
• ORF Type: complete

Annotations of Ll_transcript_211240

• Blastp: DUF724 domain-containing protein 3 from Arabidopsis with 29.85% of identity
• Blastx: DUF724 domain-containing protein 3 from Arabidopsis with 30.19% of identity
• Eggnog: Protein of unknown function (DUF724)(ENOG410YXA1)
• Kegg: Link to kegg annotations (AT1G26540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441210.1)
• Pfam: Agenet domain (PF05641.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;