Protein coding transcript 247956

• Transcript: Ll_transcript_212939
• CDS coordinates: 1-474 (+)
• Peptide sequence: STLSLPLFTGGKVEGEQGAPIHVVLVDADNENVVITGPEASVKLDVVVLEGDFNNEDDEDWTQEEFESHVVKEREGKRPLLTGELQVTLKEGIGTLGELTFTDNSSWIRSRKFRLGLKVASGFSESIRIREAKTEAFTVKDHRGECRVMFLYFLPFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_212939

• Blastp: Calmodulin-binding protein 60 D from Arabidopsis with 81.38% of identity
• Blastx: Calmodulin-binding protein 60 D from Arabidopsis with 68.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G25800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442255.1)
• Pfam: Calmodulin binding protein-like (PF07887.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;