Protein coding transcript 2481

• Transcript: Ll_transcript_524757
• CDS coordinates: 3-707 (+)
• Peptide sequence: FPSLMKKSIMSNKITLAIFFLLNVIFASSDSKSDSKAYILALQWPNTTCFMNGKTISKTVKNPKSFGIHGLWPSNSEQTSKEPFPKDGFKSLCPQTLQMEIPIYWPNMIEDNNAKLWSIEWNKHGRCSGFDICTYFWNTLGLFKTLRAINLVGELEKASKPVVVGNSYDLSTLSAAFKETLGGGKNDILIRCAKIGEKYYLWEVHVYLDAKLTRVQPPEVARGCGSTIIFPSPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_524757

• Blastp: Ribonuclease 1 from Arabidopsis with 27.92% of identity
• Blastx: Ribonuclease T2 from Homo with 30.07% of identity
• Eggnog: ribonuclease T2 activity(ENOG4111M7G)
• Kegg: Link to kegg annotations (AT2G02990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447192.1)
• Pfam: Ribonuclease T2 family (PF00445.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;