Transcript | Ll_transcript_210715 |
---|---|
CDS coordinates | 652-1401 (+) |
Peptide sequence | MMTPNLNLEPENNSEECSQEASNISLQETPYDLNHTKESTTSSSCLTNLTNAASMTLDLTLNFNSNDAKFKGTSDTSTNIGAEALAPATETPRVFSCNYCRRKFFSSQALGGHQNAHKRERTMAKRAMRMGMFNERYTNLASLPLKGSPFRSLGIEAHAAMHQRYMQMPSALVRVPDMKGGAKFERNHFGAPIFMADDDVSLFWPGSFRRVEHGSCVNLGHAQTSNTSFVPMPLPPPQTSSSPDLTLKL* |
ORF Type | complete |
Blastp | Zinc finger protein 4 from Arabidopsis with 44.32% of identity |
---|---|
Blastx | Zinc finger protein 4 from Arabidopsis with 44.32% of identity |
Eggnog | Zinc finger protein(ENOG410ZCT7) |
Kegg | Link to kegg annotations (AT1G66140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448359.1) |
Pfam | C2H2-type zinc finger (PF13912.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer