Protein coding transcript 24811

• Transcript: Ll_transcript_390063
• CDS coordinates: 227-589 (+)
• Peptide sequence: MEGSAMHNPRSVEEVFTDFKSRRTAIIKALTIDVEDFFHQCDPDKENLCLYGFPSEHWEVNLPAEEVPPELPEPVLGINFARDGMQQKDWLTLVAVHSDAWLLSVAFYFGAKFGFDKADR*
• ORF Type: complete

Annotations of Ll_transcript_390063

• Blastp: PHD finger protein ALFIN-LIKE 4 from Oryza sativa with 73.04% of identity
• Blastx: PHD finger protein ALFIN-LIKE 9 from Oryza sativa with 82.76% of identity
• Eggnog: chromatin modification(ENOG410XP9I)
• Kegg: Link to kegg annotations (4335954)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414262.1)
• Pfam: Alfin (PF12165.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;